PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G31640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 197aa    MW: 22442.5 Da    PI: 11.5887
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G31640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26048.91.9e-1511216448100
           DUF260  48 alpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      +l   ++ da+sslvyeA+ r+rdPvyG+vg i+ +q+q++ql+ +la+++ e
  ORUFI02G31640.1 112 ELLARQQGDAVSSLVYEANDRMRDPVYGCVGAISFMQNQVSQLQMQLAVAQGE 164
                      45667899****************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031954.4E-13112162IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MAMRPKPAGR RRRLAKASRA EQRRAKPKGR IGWRRVERRR SKPKGRSSAA AGGEVAIRRR  60
SRSPQQRRVS FSHVVVAAAA ATWPVTDRHY REDWDDVQWV AVRVVQAAAA AELLARQQGD  120
AVSSLVYEAN DRMRDPVYGC VGAISFMQNQ VSQLQMQLAV AQGEILCIQM QHRDGNENKK  180
NVREEEERED GKKERRC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0039831e-148AP003983.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1038_A06.
GenBankAP0041651e-148AP004165.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1479_B12.
GenBankAP0149581e-148AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624534.15e-57PREDICTED: LOB domain-containing protein 12-like
TrEMBLA0A0E0NK141e-140A0A0E0NK14_ORYRU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-26LBD family protein